Loading debian/tests/run-unit-test +15 −7 Original line number Diff line number Diff line Loading @@ -115,6 +115,12 @@ end_out="$(grep -c "<Object-id_id>${last_id}</Object-id_id>" dsRNA_viruses.xgs)" grep 'GI:' nc0225.gbk | head | sed 's/.*GI://' > GIs.txt if nc -z -w 1 www.ncbi.nlm.nih.gov 80; then ################################################################## echo '---gbseqget test---' ################################################################## /usr/bin/gbseqget -i GIs.txt -o gbseqget.xml [ -s gbseqget.xml ] check_GI gbseqget.xml GIs.txt ################################################################## echo '---insdseqget test---' ################################################################## Loading @@ -127,13 +133,6 @@ if nc -z -w 1 www.ncbi.nlm.nih.gov 80; then /usr/bin/idfetch -G GIs.txt -o idfetch.text [ -s idfetch.text ] check_GI idfetch.text GIs.txt ################################################################## echo '---makeset test---' ################################################################## echo 'idfetch.text' > files /usr/bin/makeset -i files -o makeset.aso [ -s makeset.aso ] fi Loading Loading @@ -183,6 +182,15 @@ echo '---gil2bin test---' /usr/bin/gil2bin -i GIs.txt -o GIs.bin [ -s GIs.bin ] echo '---makeset test---' echo 'idfetch_g1234.npset' > files /usr/bin/makeset -i files -o makeset.output [ -s makeset.output ] echo '---nps2gps test---' /usr/bin/nps2gps -i idfetch_g1234.npset -o nps2gps.output [ -s nps2gps.output ] echo '---tbl2asn test---' /usr/bin/tbl2asn -t Sc_16.sbt -i Sc_16.fsa [ -s Sc_16.sqn ] Loading debian/tests/test-data/idfetch_g1234.npset 0 → 100644 +457 −0 Original line number Diff line number Diff line Seq-entry ::= set { level 1 , class nuc-prot , descr { source { org { taxname "Ovis aries" , common "sheep" , db { { db "taxon" , tag id 9940 } } , orgname { name binomial { genus "Ovis" , species "aries" } , mod { { subtype strain , subname "domestic" } } , lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia; Pecora; Bovidae; Caprinae; Ovis" , gcode 1 , mgcode 2 , div "MAM" } } , subtype { { subtype other , name "Allele: C4-2H.1" } } } , pub { pub { sub { authors { names std { { name name { last "Ren" , initials "X." } } } , affil str "X. Ren, The MRC Immunochemistry Unit, Dept of Biochemistry, University of Oxford, South Parks Road, Oxford OX1 3QU, UK" } , medium other , date std { year 1992 , month 6 , day 22 } } } } , pub { pub { pmid 8423050 , article { title { name "The thioester and isotypic sites of complement component C4 in sheep and cattle." } , authors { names std { { name name { last "Ren" , initials "X.D." } } , { name name { last "Dodds" , initials "A.W." } } , { name name { last "Law" , initials "S.K." } } } , affil str "Department of Biochemistry, University of Oxford, UK." } , from journal { title { iso-jta "Immunogenetics" , ml-jta "Immunogenetics" , issn "0093-7711" , name "Immunogenetics" } , imp { date std { year 1993 } , volume "37" , issue "2" , pages "120-128" , language "eng" , pubstatus ppublish , history { { pubstatus pubmed , date std { year 1993 , month 1 , day 1 } } , { pubstatus medline , date std { year 1993 , month 1 , day 1 , hour 0 , minute 1 } } , { pubstatus other , date std { year 1993 , month 1 , day 1 , hour 0 , minute 0 } } } } } , ids { doi "10.1007/BF00216835" , pubmed 8423050 } } } } , comment "See also X66994-99" , update-date std { year 2016 , month 7 , day 14 } } , seq-set { seq { id { embl { accession "X66994" , version 1 } , gi 1234 } , descr { title "O.aries (C4-2H.1) C4 gene" , molinfo { biomol genomic } , embl { div mam , creation-date std { year 1992 , month 7 , day 10 } , update-date std { year 2006 , month 11 , day 14 } , keywords { "complement component" , "complement component C4" } } , create-date std { year 1992 , month 7 , day 10 } } , inst { repr raw , mol dna , length 945 , seq-data ncbi2na '50A79AA040538577E9D411E9E7D59C5E8421624BA25E7955E214285996E 8DD35202BDE2E49A624A2EA94A22A4BC3A09EA497ABAD224A8222392D54BA00AAF17FD45ECEBB8 5D2793F5FD429C4668D4A0FD80088EBD73AA7EBC4DA84B245EB8BFA28BB5EAEEEA2A94AFEB8492 25273CEA2240CA1592CFAD53B91ECBB7229CD509CE5FDDD7729D1A5FEE78231E2FE9528D2BA9A7 71C009C4A21253BA79FD5241A8E3A74F51855ED7BCD44A8CE4ACE89EA29EA52A9128AA22D15E55 D9476EBE79E79E70B6F12DBB5077B9855321A49514A759ED5EABDD4A42047A2EAF94FD7DD43939 0BBFDE547D052A29F2EA098C0'H } , annot { { data ftable { { data rna { type mRNA } , partial TRUE , location mix { int { from 0 , to 133 , id gi 1234 , fuzz-from lim lt } , int { from 298 , to 373 , id gi 1234 } , int { from 530 , to 686 , id gi 1234 } , int { from 924 , to 944 , id gi 1234 , fuzz-to lim gt } } } , { data imp { key "exon" } , partial TRUE , location int { from 0 , to 133 , id gi 1234 , fuzz-from lim lt } , qual { { qual "number" , val "24" } } } , { data imp { key "misc_feature" } , comment "thioester site" , location int { from 7 , to 18 , id gi 1234 } } , { data imp { key "intron" } , location int { from 134 , to 297 , id gi 1234 } , qual { { qual "number" , val "24" } } } , { data imp { key "exon" } , location int { from 298 , to 373 , id gi 1234 } , qual { { qual "number" , val "25" } } } , { data imp { key "intron" } , location int { from 374 , to 529 , id gi 1234 } , qual { { qual "number" , val "25" } } } , { data imp { key "exon" } , location int { from 530 , to 686 , id gi 1234 } , qual { { qual "number" , val "26" } } } , { data imp { key "misc_feature" } , comment "isotypic site" , location int { from 657 , to 674 , id gi 1234 } } , { data imp { key "intron" } , location int { from 687 , to 923 , id gi 1234 } , qual { { qual "number" , val "26" } } } , { data imp { key "exon" } , partial TRUE , location int { from 924 , to 944 , id gi 1234 , fuzz-to lim gt } , qual { { qual "number" , val "27" } } } , { data gene { locus "C4" } , partial TRUE , location int { from 0 , to 944 , id gi 1234 , fuzz-from lim lt , fuzz-to lim gt } } } } } } , seq { id { embl { accession "CAA47393" , version 1 } , gi 1235 } , descr { title "complement component C4, partial [Ovis aries]" , molinfo { biomol peptide , completeness no-ends } , create-date std { year 1992 , month 7 , day 10 } } , inst { repr raw , mol aa , length 129 , seq-data ncbieaa "QGCGEQTMTLLAPTLAASRYLDKTEQWSLLPPETKDRAVDLIQKGYTRIQEFRKRDGSY GAWLHRDSSTWLTAFVLKILSLAQDQVGGSTKKLQETAMWLLSQQRDDGSFHDPCPVIHRDMQGGLVGSD" } , annot { { data ftable { { data prot { name { "complement component C4" } } , partial TRUE , location int { from 0 , to 128 , id gi 1235 , fuzz-from lim lt , fuzz-to lim gt } } } } } } } , annot { { data ftable { { data cdregion { frame two , code { id 1 } } , partial TRUE , product whole gi 1235 , location mix { int { from 0 , to 133 , id gi 1234 , fuzz-from lim lt } , int { from 298 , to 373 , id gi 1234 } , int { from 530 , to 686 , id gi 1234 } , int { from 924 , to 944 , id gi 1234 , fuzz-to lim gt } } , dbxref { { db "GOA" , tag str "Q29410" } , { db "HSSP" , tag str "1HZF" } , { db "InterPro" , tag str "IPR008930" } , { db "InterPro" , tag str "IPR011626" } , { db "InterPro" , tag str "IPR019565" } , { db "UniProtKB/TrEMBL" , tag str "Q29410" } } } } } } } Loading
debian/tests/run-unit-test +15 −7 Original line number Diff line number Diff line Loading @@ -115,6 +115,12 @@ end_out="$(grep -c "<Object-id_id>${last_id}</Object-id_id>" dsRNA_viruses.xgs)" grep 'GI:' nc0225.gbk | head | sed 's/.*GI://' > GIs.txt if nc -z -w 1 www.ncbi.nlm.nih.gov 80; then ################################################################## echo '---gbseqget test---' ################################################################## /usr/bin/gbseqget -i GIs.txt -o gbseqget.xml [ -s gbseqget.xml ] check_GI gbseqget.xml GIs.txt ################################################################## echo '---insdseqget test---' ################################################################## Loading @@ -127,13 +133,6 @@ if nc -z -w 1 www.ncbi.nlm.nih.gov 80; then /usr/bin/idfetch -G GIs.txt -o idfetch.text [ -s idfetch.text ] check_GI idfetch.text GIs.txt ################################################################## echo '---makeset test---' ################################################################## echo 'idfetch.text' > files /usr/bin/makeset -i files -o makeset.aso [ -s makeset.aso ] fi Loading Loading @@ -183,6 +182,15 @@ echo '---gil2bin test---' /usr/bin/gil2bin -i GIs.txt -o GIs.bin [ -s GIs.bin ] echo '---makeset test---' echo 'idfetch_g1234.npset' > files /usr/bin/makeset -i files -o makeset.output [ -s makeset.output ] echo '---nps2gps test---' /usr/bin/nps2gps -i idfetch_g1234.npset -o nps2gps.output [ -s nps2gps.output ] echo '---tbl2asn test---' /usr/bin/tbl2asn -t Sc_16.sbt -i Sc_16.fsa [ -s Sc_16.sqn ] Loading
debian/tests/test-data/idfetch_g1234.npset 0 → 100644 +457 −0 Original line number Diff line number Diff line Seq-entry ::= set { level 1 , class nuc-prot , descr { source { org { taxname "Ovis aries" , common "sheep" , db { { db "taxon" , tag id 9940 } } , orgname { name binomial { genus "Ovis" , species "aries" } , mod { { subtype strain , subname "domestic" } } , lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia; Pecora; Bovidae; Caprinae; Ovis" , gcode 1 , mgcode 2 , div "MAM" } } , subtype { { subtype other , name "Allele: C4-2H.1" } } } , pub { pub { sub { authors { names std { { name name { last "Ren" , initials "X." } } } , affil str "X. Ren, The MRC Immunochemistry Unit, Dept of Biochemistry, University of Oxford, South Parks Road, Oxford OX1 3QU, UK" } , medium other , date std { year 1992 , month 6 , day 22 } } } } , pub { pub { pmid 8423050 , article { title { name "The thioester and isotypic sites of complement component C4 in sheep and cattle." } , authors { names std { { name name { last "Ren" , initials "X.D." } } , { name name { last "Dodds" , initials "A.W." } } , { name name { last "Law" , initials "S.K." } } } , affil str "Department of Biochemistry, University of Oxford, UK." } , from journal { title { iso-jta "Immunogenetics" , ml-jta "Immunogenetics" , issn "0093-7711" , name "Immunogenetics" } , imp { date std { year 1993 } , volume "37" , issue "2" , pages "120-128" , language "eng" , pubstatus ppublish , history { { pubstatus pubmed , date std { year 1993 , month 1 , day 1 } } , { pubstatus medline , date std { year 1993 , month 1 , day 1 , hour 0 , minute 1 } } , { pubstatus other , date std { year 1993 , month 1 , day 1 , hour 0 , minute 0 } } } } } , ids { doi "10.1007/BF00216835" , pubmed 8423050 } } } } , comment "See also X66994-99" , update-date std { year 2016 , month 7 , day 14 } } , seq-set { seq { id { embl { accession "X66994" , version 1 } , gi 1234 } , descr { title "O.aries (C4-2H.1) C4 gene" , molinfo { biomol genomic } , embl { div mam , creation-date std { year 1992 , month 7 , day 10 } , update-date std { year 2006 , month 11 , day 14 } , keywords { "complement component" , "complement component C4" } } , create-date std { year 1992 , month 7 , day 10 } } , inst { repr raw , mol dna , length 945 , seq-data ncbi2na '50A79AA040538577E9D411E9E7D59C5E8421624BA25E7955E214285996E 8DD35202BDE2E49A624A2EA94A22A4BC3A09EA497ABAD224A8222392D54BA00AAF17FD45ECEBB8 5D2793F5FD429C4668D4A0FD80088EBD73AA7EBC4DA84B245EB8BFA28BB5EAEEEA2A94AFEB8492 25273CEA2240CA1592CFAD53B91ECBB7229CD509CE5FDDD7729D1A5FEE78231E2FE9528D2BA9A7 71C009C4A21253BA79FD5241A8E3A74F51855ED7BCD44A8CE4ACE89EA29EA52A9128AA22D15E55 D9476EBE79E79E70B6F12DBB5077B9855321A49514A759ED5EABDD4A42047A2EAF94FD7DD43939 0BBFDE547D052A29F2EA098C0'H } , annot { { data ftable { { data rna { type mRNA } , partial TRUE , location mix { int { from 0 , to 133 , id gi 1234 , fuzz-from lim lt } , int { from 298 , to 373 , id gi 1234 } , int { from 530 , to 686 , id gi 1234 } , int { from 924 , to 944 , id gi 1234 , fuzz-to lim gt } } } , { data imp { key "exon" } , partial TRUE , location int { from 0 , to 133 , id gi 1234 , fuzz-from lim lt } , qual { { qual "number" , val "24" } } } , { data imp { key "misc_feature" } , comment "thioester site" , location int { from 7 , to 18 , id gi 1234 } } , { data imp { key "intron" } , location int { from 134 , to 297 , id gi 1234 } , qual { { qual "number" , val "24" } } } , { data imp { key "exon" } , location int { from 298 , to 373 , id gi 1234 } , qual { { qual "number" , val "25" } } } , { data imp { key "intron" } , location int { from 374 , to 529 , id gi 1234 } , qual { { qual "number" , val "25" } } } , { data imp { key "exon" } , location int { from 530 , to 686 , id gi 1234 } , qual { { qual "number" , val "26" } } } , { data imp { key "misc_feature" } , comment "isotypic site" , location int { from 657 , to 674 , id gi 1234 } } , { data imp { key "intron" } , location int { from 687 , to 923 , id gi 1234 } , qual { { qual "number" , val "26" } } } , { data imp { key "exon" } , partial TRUE , location int { from 924 , to 944 , id gi 1234 , fuzz-to lim gt } , qual { { qual "number" , val "27" } } } , { data gene { locus "C4" } , partial TRUE , location int { from 0 , to 944 , id gi 1234 , fuzz-from lim lt , fuzz-to lim gt } } } } } } , seq { id { embl { accession "CAA47393" , version 1 } , gi 1235 } , descr { title "complement component C4, partial [Ovis aries]" , molinfo { biomol peptide , completeness no-ends } , create-date std { year 1992 , month 7 , day 10 } } , inst { repr raw , mol aa , length 129 , seq-data ncbieaa "QGCGEQTMTLLAPTLAASRYLDKTEQWSLLPPETKDRAVDLIQKGYTRIQEFRKRDGSY GAWLHRDSSTWLTAFVLKILSLAQDQVGGSTKKLQETAMWLLSQQRDDGSFHDPCPVIHRDMQGGLVGSD" } , annot { { data ftable { { data prot { name { "complement component C4" } } , partial TRUE , location int { from 0 , to 128 , id gi 1235 , fuzz-from lim lt , fuzz-to lim gt } } } } } } } , annot { { data ftable { { data cdregion { frame two , code { id 1 } } , partial TRUE , product whole gi 1235 , location mix { int { from 0 , to 133 , id gi 1234 , fuzz-from lim lt } , int { from 298 , to 373 , id gi 1234 } , int { from 530 , to 686 , id gi 1234 } , int { from 924 , to 944 , id gi 1234 , fuzz-to lim gt } } , dbxref { { db "GOA" , tag str "Q29410" } , { db "HSSP" , tag str "1HZF" } , { db "InterPro" , tag str "IPR008930" } , { db "InterPro" , tag str "IPR011626" } , { db "InterPro" , tag str "IPR019565" } , { db "UniProtKB/TrEMBL" , tag str "Q29410" } } } } } } }